YTMP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTMP - Putative phosphotransferase YtmP

UniProt:	C0SPC1	Sequences: MENGDVITAQHWMTGRELKPKDMSGRPVAELLRKIHTSKALLDMLKRLGKEPLNPGALLSQLKQAVFAVQQSSPLIQEGIKYLEEHLHEVHFGEKVVCHCDVNHNNWLLSEDNQLYLIDWDGAMIADPAMDLGPLLYHYVEKPAWESWLSMYGIELTESLRLRMAWYVLSETITFIAWHKAKGNDKEFHDAMEELHILMKRIVD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	204 (197)
Sequences:	262 (200)
Seq/√Len:	14.2

BACSU - YTMP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_M	50_K	3.812	1.00
33_R	37_T	3.592	0.99
63_K	84_E	3.263	0.99
107_W	129_A	3.092	0.98
17_E	118_I	2.786	0.96
76_I	138_H	2.674	0.95
32_L	107_W	2.495	0.93
133_G	164_M	2.433	0.92
29_A	160_L	2.375	0.91
132_L	156_L	2.324	0.90
3_N	121_D	2.309	0.89
42_L	125_I	2.303	0.89
27_P	113_N	2.214	0.87
45_L	50_K	2.147	0.85
17_E	105_N	2.139	0.85
164_M	195_L	2.105	0.84
96_V	121_D	2.057	0.83
44_M	97_V	1.930	0.79
35_I	98_C	1.894	0.77
146_E	150_S	1.820	0.74
67_F	188_F	1.814	0.74
125_I	164_M	1.812	0.74
47_R	121_D	1.787	0.73
7_I	105_N	1.783	0.73
17_E	164_M	1.782	0.73
135_L	162_L	1.758	0.72
35_I	105_N	1.746	0.71
121_D	136_L	1.741	0.71
45_L	124_M	1.736	0.71
138_H	191_A	1.734	0.70
16_R	47_R	1.696	0.69
116_Y	174_T	1.681	0.68
50_K	108_L	1.656	0.67
76_I	178_W	1.648	0.66
40_A	43_D	1.628	0.65
33_R	40_A	1.553	0.62
22_D	48_L	1.541	0.61
4_G	9_A	1.537	0.61
17_E	35_I	1.533	0.61
82_Y	133_G	1.497	0.59
13_M	45_L	1.472	0.57
102_V	133_G	1.469	0.57
63_K	80_I	1.461	0.57
47_R	136_L	1.456	0.56
135_L	194_E	1.445	0.56
58_L	100_C	1.443	0.56
62_L	76_I	1.427	0.55
31_L	35_I	1.424	0.55
165_A	171_E	1.414	0.54
50_K	100_C	1.385	0.53
108_L	111_E	1.375	0.52
17_E	125_I	1.372	0.52
64_Q	173_I	1.353	0.51
73_S	192_M	1.324	0.49
46_K	95_K	1.305	0.48
21_K	197_I	1.302	0.48
27_P	154_I	1.294	0.48
17_E	40_A	1.271	0.46
66_V	177_A	1.269	0.46
35_I	47_R	1.267	0.46
58_L	132_L	1.264	0.46
40_A	47_R	1.246	0.45
146_E	156_L	1.235	0.44
8_T	28_V	1.235	0.44
85_E	183_G	1.232	0.44
54_N	68_A	1.220	0.44
6_V	123_A	1.211	0.43
21_K	24_S	1.200	0.43
187_E	191_A	1.200	0.43
35_I	42_L	1.191	0.42
63_K	100_C	1.190	0.42
11_H	164_M	1.188	0.42
91_H	140_V	1.186	0.42
108_L	188_F	1.183	0.42
5_D	9_A	1.179	0.41
105_N	160_L	1.175	0.41
43_D	116_Y	1.171	0.41
142_K	161_R	1.166	0.41
70_Q	189_H	1.162	0.41
48_L	105_N	1.161	0.41
138_H	171_E	1.146	0.40
68_A	76_I	1.135	0.39
24_S	37_T	1.113	0.38
47_R	169_L	1.111	0.38
102_V	122_G	1.107	0.38
8_T	47_R	1.096	0.37
3_N	63_K	1.096	0.37
3_N	16_R	1.090	0.37
111_E	114_Q	1.086	0.37
43_D	125_I	1.079	0.36
137_Y	171_E	1.079	0.36
3_N	112_D	1.078	0.36
125_I	163_R	1.077	0.36
45_L	184_N	1.072	0.36
42_L	164_M	1.049	0.35
50_K	125_I	1.048	0.35
7_I	177_A	1.048	0.35
77_Q	84_E	1.038	0.34
174_T	192_M	1.037	0.34
79_G	173_I	1.034	0.34
123_A	126_A	1.034	0.34
176_I	192_M	1.029	0.34
17_E	52_P	1.026	0.34
128_P	163_R	1.020	0.33
39_K	91_H	1.018	0.33
182_K	191_A	1.017	0.33
22_D	89_E	1.016	0.33
102_V	113_N	1.000	0.32
34_K	123_A	0.995	0.32
74_P	188_F	0.995	0.32
2_E	7_I	0.985	0.32
189_H	193_E	0.978	0.31
11_H	45_L	0.976	0.31
50_K	105_N	0.962	0.31
74_P	186_K	0.955	0.30
50_K	62_L	0.947	0.30
70_Q	177_A	0.945	0.30
48_L	125_I	0.936	0.29
79_G	161_R	0.924	0.29
68_A	80_I	0.916	0.28
4_G	10_Q	0.911	0.28
57_A	69_V	0.906	0.28
95_K	126_A	0.902	0.28
6_V	80_I	0.894	0.28
66_V	173_I	0.892	0.27
178_W	182_K	0.890	0.27
42_L	128_P	0.886	0.27
40_A	184_N	0.883	0.27
20_P	48_L	0.881	0.27
14_T	25_G	0.878	0.27
46_K	122_G	0.873	0.27
31_L	123_A	0.872	0.27
80_I	155_E	0.871	0.27
23_M	197_I	0.865	0.26
100_C	149_L	0.855	0.26
62_L	146_E	0.854	0.26
2_E	35_I	0.854	0.26
172_T	191_A	0.844	0.25
82_Y	86_H	0.843	0.25
126_A	129_A	0.840	0.25
17_E	42_L	0.837	0.25
123_A	160_L	0.835	0.25
14_T	168_V	0.834	0.25
100_C	170_S	0.832	0.25
191_A	194_E	0.826	0.25
75_L	144_A	0.823	0.25
176_I	189_H	0.823	0.25
133_G	165_A	0.821	0.24
49_G	62_L	0.820	0.24
6_V	182_K	0.820	0.24
129_A	163_R	0.820	0.24
117_L	139_Y	0.817	0.24
93_G	157_T	0.815	0.24
58_L	107_W	0.812	0.24
134_P	160_L	0.809	0.24
138_H	198_L	0.808	0.24
55_P	135_L	0.801	0.24
55_P	132_L	0.798	0.24
173_I	192_M	0.797	0.23
57_A	62_L	0.797	0.23
112_D	128_P	0.796	0.23
32_L	141_E	0.796	0.23
102_V	165_A	0.794	0.23
35_I	52_P	0.792	0.23
114_Q	143_P	0.789	0.23
8_T	12_W	0.784	0.23
28_V	134_P	0.784	0.23
81_K	197_I	0.779	0.23
45_L	108_L	0.771	0.22
126_A	167_Y	0.763	0.22
44_M	115_L	0.759	0.22
105_N	137_Y	0.753	0.22
28_V	114_Q	0.752	0.22
15_G	189_H	0.752	0.22
127_D	163_R	0.752	0.22
14_T	111_E	0.749	0.22
129_A	132_L	0.748	0.22
59_L	129_A	0.742	0.21
11_H	125_I	0.742	0.21
3_N	72_S	0.742	0.21
3_N	28_V	0.735	0.21
109_L	183_G	0.729	0.21
72_S	77_Q	0.723	0.21
173_I	191_A	0.723	0.21
6_V	136_L	0.723	0.21
37_T	194_E	0.719	0.21
5_D	16_R	0.718	0.21
118_I	182_K	0.713	0.20
45_L	100_C	0.712	0.20
3_N	98_C	0.711	0.20
62_L	100_C	0.711	0.20
35_I	40_A	0.707	0.20
87_L	158_E	0.706	0.20
110_S	134_P	0.703	0.20
82_Y	109_L	0.703	0.20
42_L	105_N	0.702	0.20
40_A	182_K	0.701	0.20
55_P	90_V	0.701	0.20
17_E	163_R	0.696	0.20
54_N	88_H	0.694	0.20
19_K	150_S	0.693	0.20
135_L	168_V	0.690	0.20
12_W	100_C	0.688	0.19
10_Q	36_H	0.688	0.19
185_D	188_F	0.686	0.19
174_T	177_A	0.680	0.19
16_R	42_L	0.678	0.19
11_H	116_Y	0.677	0.19
52_P	125_I	0.662	0.19
27_P	116_Y	0.653	0.18
31_L	98_C	0.651	0.18
96_V	105_N	0.648	0.18
3_N	96_V	0.647	0.18
39_K	88_H	0.644	0.18
13_M	108_L	0.644	0.18
14_T	95_K	0.637	0.18
29_A	146_E	0.634	0.18
11_H	189_H	0.634	0.18
97_V	103_N	0.632	0.18
49_G	170_S	0.631	0.18
29_A	35_I	0.629	0.18
51_E	181_A	0.628	0.18
92_F	185_D	0.628	0.18
53_L	100_C	0.627	0.17
133_G	168_V	0.627	0.17
7_I	35_I	0.626	0.17
65_A	177_A	0.624	0.17
48_L	52_P	0.623	0.17
76_I	171_E	0.620	0.17
118_I	164_M	0.620	0.17
96_V	132_L	0.617	0.17
78_E	146_E	0.616	0.17
73_S	189_H	0.615	0.17
27_P	59_L	0.614	0.17
100_C	198_L	0.613	0.17
147_S	170_S	0.612	0.17
21_K	146_E	0.605	0.17
86_H	165_A	0.602	0.17
40_A	82_Y	0.602	0.17
72_S	181_A	0.601	0.17
65_A	102_V	0.597	0.17
11_H	137_Y	0.597	0.17
39_K	58_L	0.594	0.16
172_T	181_A	0.593	0.16
25_G	147_S	0.590	0.16
2_E	8_T	0.589	0.16
2_E	47_R	0.588	0.16
84_E	133_G	0.588	0.16
42_L	118_I	0.586	0.16
79_G	169_L	0.583	0.16
35_I	102_V	0.580	0.16
91_H	169_L	0.579	0.16
53_L	187_E	0.578	0.16
29_A	123_A	0.577	0.16
29_A	107_W	0.574	0.16
2_E	105_N	0.573	0.16
16_R	140_V	0.573	0.16
58_L	90_V	0.572	0.16
41_L	169_L	0.571	0.16
35_I	123_A	0.570	0.16
62_L	177_A	0.567	0.16
171_E	187_E	0.563	0.16
51_E	68_A	0.561	0.15
77_Q	198_L	0.561	0.15
43_D	46_K	0.560	0.15
20_P	179_H	0.560	0.15
159_S	198_L	0.559	0.15
47_R	178_W	0.556	0.15
84_E	132_L	0.554	0.15
33_R	109_L	0.550	0.15
141_E	152_Y	0.545	0.15
16_R	22_D	0.543	0.15
122_G	191_A	0.542	0.15
90_V	170_S	0.540	0.15
63_K	183_G	0.538	0.15
47_R	179_H	0.536	0.15
66_V	70_Q	0.534	0.15
84_E	186_K	0.532	0.15
180_K	189_H	0.531	0.15
46_K	65_A	0.525	0.14
59_L	76_I	0.525	0.14
30_E	74_P	0.524	0.14
70_Q	176_I	0.521	0.14
59_L	80_I	0.521	0.14
132_L	163_R	0.518	0.14
21_K	26_R	0.517	0.14
46_K	61_Q	0.516	0.14
78_E	158_E	0.516	0.14
179_H	184_N	0.512	0.14
78_E	150_S	0.506	0.14
140_V	178_W	0.506	0.14
11_H	65_A	0.505	0.14
59_L	71_Q	0.504	0.14
171_E	191_A	0.502	0.14
23_M	48_L	0.501	0.14
80_I	111_E	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3i1aA	1	0.9902	99.9	0.746	Contact Map
3tdwA	1	0.9706	99.8	0.763	Contact Map
4dcaA	1	0.9902	99.8	0.765	Contact Map
3dxqA	1	0.9559	99.8	0.765	Contact Map
2qg7A	2	0.9755	99.8	0.777	Contact Map
4ocvA	1	0.9755	99.8	0.777	Contact Map
1nw1A	2	0.9363	99.7	0.788	Contact Map
4orkA	1	0.951	99.7	0.79	Contact Map
4pdyA	1	0.9461	99.7	0.793	Contact Map
1nd4A	2	0.7941	99.7	0.794	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.