YLXW - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLXW - UPF0749 protein YlxW

UniProt:	C0SPA3	Sequences: MRGKSAVLLSLIMLIAGFLISFSFQMTKENNKSAAETEEWKKEYALRDELLKQEKENKKFEKELYQKQNKVRQAENKLKKEKSEYYNVLEDTEKYRMYIGEVGVQGEGVEVTLEDASYIPEGENVNSYIVHESHIFQVVNELYISGAAAVAVNGQRLTHDSYIKCNGPVVTVDGVQHPAPFTVSAIGDPDVLLPSLNIAGGLIDQLSMDHISVSAEKEKNVQMKPILKTKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	231 (214)
Sequences:	1493 (1093)
Seq/√Len:	74.7

BACSU - YLXW YLXX

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
105_Q	220_N	6.044	1.00
157_L	161_S	4.732	1.00
110_E	218_E	4.274	1.00
110_E	184_S	3.879	1.00
131_H	165_C	3.099	1.00
105_Q	222_Q	2.991	1.00
193_L	217_K	2.968	1.00
154_G	184_S	2.743	1.00
155_Q	173_D	2.524	1.00
108_G	221_V	2.361	1.00
188_D	191_V	2.315	1.00
149_A	186_I	2.301	1.00
158_T	226_I	2.266	1.00
104_V	149_A	2.235	1.00
103_G	225_P	2.163	1.00
149_A	223_M	2.151	1.00
109_V	192_L	2.142	1.00
104_V	223_M	2.066	1.00
103_G	222_Q	2.059	1.00
184_S	221_V	2.048	1.00
135_I	181_F	2.030	1.00
109_V	185_A	2.014	1.00
112_T	216_E	2.012	1.00
155_Q	175_V	1.969	1.00
63_E	66_Q	1.951	1.00
148_A	186_I	1.950	1.00
110_E	182_T	1.913	1.00
139_V	152_V	1.907	1.00
189_P	192_L	1.904	1.00
114_E	212_S	1.902	1.00
190_D	217_K	1.894	1.00
115_D	165_C	1.872	1.00
203_I	213_V	1.866	1.00
139_V	163_I	1.800	1.00
132_E	165_C	1.739	1.00
153_N	181_F	1.707	1.00
135_I	170_V	1.703	1.00
154_G	182_T	1.668	1.00
115_D	131_H	1.658	1.00
111_V	196_L	1.650	1.00
12_I	19_L	1.622	1.00
17_G	21_S	1.583	0.99
151_A	154_G	1.542	0.99
89_L	93_E	1.538	0.99
104_V	148_A	1.515	0.99
151_A	224_K	1.493	0.99
61_E	65_Y	1.488	0.99
95_Y	99_I	1.487	0.99
124_N	127_S	1.472	0.99
206_L	211_I	1.463	0.99
104_V	186_I	1.443	0.99
92_T	96_R	1.385	0.98
162_Y	173_D	1.365	0.98
185_A	194_P	1.354	0.98
184_S	223_M	1.352	0.98
59_K	63_E	1.347	0.98
66_Q	70_K	1.337	0.98
188_D	192_L	1.332	0.98
172_V	177_H	1.324	0.98
45_A	49_E	1.319	0.98
109_V	189_P	1.318	0.98
69_N	73_Q	1.298	0.98
18_F	22_F	1.296	0.98
138_V	183_V	1.294	0.98
165_C	174_G	1.287	0.98
173_D	226_I	1.286	0.98
165_C	168_P	1.285	0.97
142_L	147_A	1.277	0.97
10_S	14_L	1.264	0.97
113_L	138_V	1.247	0.97
164_K	171_T	1.238	0.97
139_V	150_V	1.238	0.97
193_L	197_N	1.216	0.96
6_A	10_S	1.215	0.96
107_E	189_P	1.197	0.96
168_P	178_P	1.185	0.96
151_A	223_M	1.175	0.96
19_L	24_F	1.175	0.96
119_I	122_G	1.170	0.96
91_D	94_K	1.168	0.96
26_M	31_N	1.162	0.95
71_V	75_E	1.160	0.95
12_I	24_F	1.159	0.95
53_Q	56_E	1.150	0.95
97_M	102_V	1.149	0.95
112_T	182_T	1.139	0.95
50_L	53_Q	1.133	0.95
109_V	193_L	1.132	0.95
72_R	76_N	1.128	0.95
111_V	215_A	1.124	0.95
87_N	91_D	1.121	0.94
18_F	21_S	1.114	0.94
198_I	201_G	1.107	0.94
116_A	128_Y	1.103	0.94
144_I	202_L	1.095	0.94
8_L	12_I	1.093	0.94
166_N	171_T	1.091	0.94
152_V	183_V	1.079	0.93
67_K	71_V	1.075	0.93
132_E	164_K	1.074	0.93
75_E	96_R	1.069	0.93
99_I	102_V	1.055	0.92
108_G	184_S	1.041	0.92
143_Y	150_V	1.033	0.92
100_G	159_H	1.032	0.92
129_I	165_C	1.029	0.92
139_V	183_V	1.017	0.91
161_S	168_P	1.016	0.91
15_I	91_D	1.013	0.91
21_S	24_F	1.001	0.90
72_R	75_E	0.991	0.90
100_G	158_T	0.990	0.90
56_E	59_K	0.990	0.90
129_I	168_P	0.988	0.90
142_L	185_A	0.969	0.89
165_C	169_V	0.957	0.88
47_R	51_L	0.955	0.88
115_D	167_G	0.954	0.88
143_Y	158_T	0.938	0.87
91_D	95_Y	0.924	0.86
27_T	30_N	0.923	0.86
58_K	151_A	0.915	0.86
14_L	21_S	0.910	0.86
135_I	153_N	0.907	0.85
163_I	172_V	0.907	0.85
146_G	187_G	0.904	0.85
93_E	219_K	0.903	0.85
148_A	187_G	0.902	0.85
114_E	179_A	0.895	0.85
69_N	207_S	0.889	0.84
171_T	174_G	0.887	0.84
19_L	140_N	0.881	0.84
140_N	164_K	0.872	0.83
105_Q	221_V	0.871	0.83
149_A	187_G	0.870	0.83
141_E	201_G	0.869	0.83
107_E	148_A	0.863	0.82
10_S	23_S	0.861	0.82
191_V	194_P	0.859	0.82
206_L	213_V	0.857	0.82
12_I	16_A	0.854	0.82
46_L	50_L	0.852	0.82
23_S	26_M	0.850	0.81
165_C	181_F	0.848	0.81
132_E	168_P	0.845	0.81
53_Q	183_V	0.840	0.81
116_A	165_C	0.829	0.80
80_K	113_L	0.828	0.80
7_V	11_L	0.812	0.78
136_F	162_Y	0.811	0.78
218_E	221_V	0.799	0.77
136_F	143_Y	0.795	0.77
109_V	188_D	0.793	0.77
87_N	90_E	0.792	0.77
205_Q	209_D	0.789	0.76
103_G	224_K	0.785	0.76
10_S	21_S	0.783	0.76
108_G	218_E	0.782	0.76
192_L	221_V	0.770	0.75
153_N	187_G	0.768	0.74
50_L	202_L	0.766	0.74
169_V	177_H	0.766	0.74
166_N	176_Q	0.762	0.74
131_H	134_H	0.762	0.74
113_L	211_I	0.761	0.74
55_K	161_S	0.760	0.74
176_Q	181_F	0.760	0.74
70_K	74_A	0.758	0.73
95_Y	161_S	0.755	0.73
100_G	221_V	0.755	0.73
169_V	176_Q	0.750	0.73
85_Y	89_L	0.749	0.73
97_M	148_A	0.744	0.72
157_L	163_I	0.737	0.71
6_A	109_V	0.736	0.71
65_Y	69_N	0.725	0.70
163_I	173_D	0.723	0.70
74_A	103_G	0.722	0.70
88_V	91_D	0.719	0.69
145_S	195_S	0.719	0.69
132_E	153_N	0.718	0.69
49_E	177_H	0.717	0.69
62_K	73_Q	0.714	0.69
53_Q	60_F	0.713	0.69
13_M	16_A	0.711	0.69
142_L	150_V	0.708	0.68
11_L	34_A	0.708	0.68
14_L	18_F	0.699	0.67
137_Q	170_V	0.695	0.67
135_I	183_V	0.693	0.67
33_S	41_K	0.689	0.66
195_S	201_G	0.687	0.66
186_I	221_V	0.684	0.66
10_S	192_L	0.679	0.65
77_K	219_K	0.678	0.65
10_S	17_G	0.675	0.65
170_V	199_A	0.666	0.64
45_A	74_A	0.665	0.63
16_A	23_S	0.661	0.63
64_L	68_Q	0.658	0.63
147_A	150_V	0.656	0.62
22_F	26_M	0.656	0.62
162_Y	169_V	0.656	0.62
98_Y	143_Y	0.656	0.62
64_L	71_V	0.655	0.62
23_S	136_F	0.654	0.62
171_T	176_Q	0.649	0.62
50_L	133_S	0.646	0.61
163_I	215_A	0.645	0.61
163_I	176_Q	0.638	0.60
130_V	191_V	0.636	0.60
42_K	50_L	0.634	0.60
48_D	52_K	0.634	0.60
132_E	206_L	0.630	0.59
74_A	88_V	0.630	0.59
43_E	192_L	0.629	0.59
113_L	206_L	0.623	0.58
113_L	135_I	0.620	0.58
189_P	219_K	0.617	0.58
90_E	93_E	0.617	0.58
113_L	213_V	0.616	0.58
194_P	198_I	0.613	0.57
8_L	19_L	0.604	0.56
167_G	170_V	0.604	0.56
137_Q	155_Q	0.601	0.56
121_E	125_V	0.600	0.56
11_L	99_I	0.593	0.55
134_H	162_Y	0.593	0.55
191_V	204_D	0.592	0.55
29_E	32_K	0.591	0.55
93_E	96_R	0.590	0.54
132_E	177_H	0.589	0.54
151_A	173_D	0.587	0.54
81_E	91_D	0.584	0.54
78_L	219_K	0.583	0.54
152_V	163_I	0.582	0.53
59_K	93_E	0.581	0.53
29_E	65_Y	0.580	0.53
132_E	167_G	0.578	0.53
108_G	219_K	0.577	0.53
184_S	218_E	0.575	0.53
119_I	222_Q	0.574	0.52
25_Q	79_K	0.572	0.52
152_V	190_D	0.572	0.52
22_F	157_L	0.572	0.52
129_I	169_V	0.570	0.52
151_A	186_I	0.567	0.52
204_D	213_V	0.567	0.52
155_Q	174_G	0.566	0.51
90_E	94_K	0.566	0.51
19_L	23_S	0.565	0.51
191_V	220_N	0.563	0.51
114_E	182_T	0.562	0.51
120_P	123_E	0.561	0.51
13_M	99_I	0.560	0.51
128_Y	168_P	0.558	0.50
7_V	10_S	0.556	0.50
10_S	13_M	0.554	0.50
125_V	157_L	0.554	0.50
134_H	210_H	0.554	0.50
19_L	116_A	0.554	0.50
89_L	216_E	0.553	0.50
63_E	67_K	0.551	0.50
153_N	168_P	0.551	0.50
131_H	169_V	0.549	0.49
150_V	157_L	0.547	0.49
151_A	184_S	0.546	0.49
45_A	48_D	0.546	0.49
9_L	221_V	0.545	0.49
173_D	206_L	0.544	0.49
131_H	168_P	0.543	0.49
76_N	219_K	0.543	0.49
13_M	20_I	0.543	0.49
70_K	73_Q	0.543	0.49
139_V	157_L	0.543	0.49
114_E	220_N	0.539	0.48
22_F	161_S	0.539	0.48
111_V	183_V	0.534	0.47
130_V	171_T	0.534	0.47
49_E	53_Q	0.532	0.47
141_E	145_S	0.531	0.47
123_E	127_S	0.530	0.47
139_V	166_N	0.528	0.47
25_Q	80_K	0.527	0.47
147_A	185_A	0.526	0.46
115_D	149_A	0.524	0.46
130_V	164_K	0.522	0.46
134_H	140_N	0.522	0.46
30_N	34_A	0.521	0.46
81_E	111_V	0.521	0.46
8_L	94_K	0.520	0.46
66_Q	86_Y	0.519	0.46
171_T	181_F	0.519	0.46
128_Y	169_V	0.517	0.45
86_Y	90_E	0.516	0.45
125_V	128_Y	0.516	0.45
130_V	212_S	0.516	0.45
151_A	225_P	0.516	0.45
133_S	174_G	0.515	0.45
98_Y	198_I	0.515	0.45
115_D	130_V	0.515	0.45
169_V	173_D	0.514	0.45
64_L	89_L	0.514	0.45
19_L	160_D	0.513	0.45
172_V	205_Q	0.512	0.45
113_L	183_V	0.511	0.45
89_L	215_A	0.510	0.44
56_E	111_V	0.509	0.44
165_C	178_P	0.508	0.44
128_Y	202_L	0.507	0.44
45_A	62_K	0.507	0.44
146_G	181_F	0.506	0.44
149_A	157_L	0.506	0.44
79_K	89_L	0.506	0.44
58_K	77_K	0.506	0.44
12_I	96_R	0.506	0.44
43_E	50_L	0.505	0.44
97_M	166_N	0.503	0.44
140_N	160_D	0.503	0.44
75_E	78_L	0.503	0.44
145_S	213_V	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gmgA	2	0.5714	100	0.333	Contact Map
4cgkA	3	0.5974	87	0.923	Contact Map
4q4gX	1	0	79.3	0.93	Contact Map
3hnwA	2	0.3896	78	0.931	Contact Map
3rvyA	3	0.1169	77.1	0.931	Contact Map
1debA	4	0.2338	73.6	0.933	Contact Map
4cbcA	3	0.1429	72.2	0.934	Contact Map
4bgnA	3	0.1732	71.6	0.934	Contact Map
2yy0A	6	0.2294	68.9	0.935	Contact Map
4ltoA	3	0.3247	67.2	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.