C0H460 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

C0H460 - Uncharacterized protein

UniProt:	C0H460	Sequences: MANKHTAGREQLGEFAPKFAELHDDVLFGDIWAREEELSSRDRSMITVSALITDCFSAYKSGSF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	64 (56)
Sequences:	702 (366)
Seq/√Len:	48.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_K	21_E	4.422	1.00
33_A	40_S	3.145	1.00
21_E	25_D	3.084	1.00
39_S	42_D	2.261	1.00
21_E	30_D	2.149	1.00
48_V	60_K	2.095	1.00
18_K	22_L	2.080	1.00
59_Y	63_S	1.955	0.99
34_R	37_E	1.935	0.99
12_L	16_A	1.865	0.99
43_R	47_T	1.830	0.99
13_G	20_A	1.687	0.98
11_Q	14_E	1.638	0.98
42_D	45_M	1.620	0.98
50_A	53_T	1.607	0.98
28_F	63_S	1.422	0.95
27_L	44_S	1.362	0.94
32_W	44_S	1.275	0.91
12_L	19_F	1.216	0.89
28_F	59_Y	1.206	0.89
30_D	34_R	1.142	0.86
27_L	32_W	1.048	0.81
16_A	26_V	1.042	0.80
52_I	55_C	1.033	0.80
15_F	20_A	1.012	0.78
26_V	44_S	0.994	0.77
40_S	62_G	0.988	0.77
58_A	61_S	0.978	0.76
9_R	12_L	0.961	0.75
8_G	24_D	0.938	0.73
45_M	61_S	0.917	0.71
45_M	54_D	0.871	0.67
18_K	30_D	0.825	0.63
39_S	52_I	0.807	0.61
35_E	61_S	0.800	0.61
27_L	31_I	0.793	0.60
53_T	56_F	0.791	0.60
10_E	19_F	0.786	0.59
28_F	44_S	0.765	0.57
48_V	62_G	0.757	0.56
11_Q	62_G	0.747	0.55
50_A	54_D	0.742	0.55
35_E	39_S	0.737	0.54
51_L	63_S	0.715	0.52
8_G	57_S	0.691	0.50
52_I	57_S	0.678	0.48
32_W	42_D	0.672	0.48
22_L	47_T	0.668	0.47
7_A	29_G	0.660	0.46
9_R	14_E	0.645	0.45
24_D	29_G	0.640	0.44
51_L	61_S	0.636	0.44
44_S	51_L	0.626	0.43
35_E	50_A	0.620	0.42
55_C	58_A	0.606	0.41
11_Q	15_F	0.605	0.41
43_R	62_G	0.603	0.41
28_F	58_A	0.600	0.41
16_A	29_G	0.592	0.40
45_M	49_S	0.589	0.39
32_W	46_I	0.586	0.39
8_G	13_G	0.582	0.39
40_S	63_S	0.574	0.38
17_P	39_S	0.571	0.38
55_C	63_S	0.569	0.38
31_I	62_G	0.563	0.37
32_W	41_R	0.554	0.36
28_F	55_C	0.542	0.35
41_R	45_M	0.541	0.35
10_E	13_G	0.539	0.35
16_A	37_E	0.532	0.34
18_K	35_E	0.530	0.34
49_S	52_I	0.529	0.34
20_A	33_A	0.526	0.34
27_L	42_D	0.521	0.33
23_H	32_W	0.517	0.33
24_D	44_S	0.516	0.33
18_K	34_R	0.509	0.32
10_E	23_H	0.509	0.32
12_L	15_F	0.508	0.32
7_A	12_L	0.505	0.32
8_G	29_G	0.505	0.32
19_F	35_E	0.502	0.31
23_H	61_S	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g9qA	3	0.9844	99.3	0.448	Contact Map
2af7A	6	0.9844	98.5	0.601	Contact Map
2q0tA	3	0.9688	97.8	0.665	Contact Map
3d7iA	6	0.875	97.7	0.676	Contact Map
1vkeA	6	0.9531	97.6	0.679	Contact Map
1p8cA	6	0.9688	97.5	0.687	Contact Map
3beyA	6	0.8906	97.4	0.694	Contact Map
2qeuA	6	1	96.8	0.718	Contact Map
2cwqA	4	0.9375	95	0.759	Contact Map
2ouwA	6	0.9688	90.2	0.795	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.