S5AEB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

S5AEB - Stage V sporulation protein AEB

UniProt:	C0H450	Sequences: MDYLLAFVCGGAICIVGQLLLDIFKLTPAHVMTSFVVIGAILDGFGIYDKFIEFAGGGATVPIVSFGHSLLHGAMHQAHIHGFIGIGMGIFELTSAGISAAILFAFIVAVIFKPKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	116 (114)
Sequences:	588 (302)
Seq/√Len:	28.3

BACSU - S5AEB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_D	68_H	5.067	1.00
49_D	53_E	3.686	1.00
19_L	23_I	3.486	1.00
43_D	72_H	3.355	1.00
69_S	94_T	3.243	1.00
13_I	35_F	2.991	1.00
5_L	8_V	2.931	1.00
94_T	98_I	2.762	1.00
5_L	54_F	2.585	0.99
100_A	104_F	2.329	0.99
74_A	86_I	2.281	0.98
88_M	96_A	2.190	0.98
76_H	80_I	2.168	0.98
8_V	12_A	2.004	0.97
77_Q	92_E	1.944	0.96
17_G	35_F	1.740	0.92
49_D	68_H	1.738	0.92
48_Y	59_A	1.705	0.92
16_V	38_I	1.655	0.90
19_L	111_I	1.606	0.89
6_A	56_G	1.578	0.88
21_L	31_V	1.510	0.86
26_L	34_S	1.490	0.85
68_H	72_H	1.467	0.84
9_C	13_I	1.449	0.83
44_G	71_L	1.424	0.82
40_A	71_L	1.364	0.79
9_C	55_A	1.364	0.79
99_S	103_L	1.314	0.77
24_F	31_V	1.308	0.76
86_I	103_L	1.303	0.76
73_G	93_L	1.299	0.76
9_C	54_F	1.282	0.75
19_L	24_F	1.263	0.74
85_G	97_G	1.262	0.74
83_F	86_I	1.253	0.73
74_A	78_A	1.219	0.71
105_A	110_V	1.186	0.69
29_A	34_S	1.145	0.66
83_F	96_A	1.108	0.64
90_I	95_S	1.094	0.63
38_I	41_I	1.080	0.62
6_A	114_P	1.077	0.61
65_S	90_I	1.065	0.60
20_L	23_I	1.060	0.60
45_F	50_K	1.048	0.59
24_F	30_H	1.046	0.59
65_S	93_L	1.032	0.58
15_I	91_F	1.019	0.57
17_G	64_V	1.010	0.56
8_V	15_I	0.998	0.55
49_D	72_H	0.976	0.54
77_Q	80_I	0.968	0.53
73_G	89_G	0.957	0.52
4_L	8_V	0.953	0.52
77_Q	93_L	0.940	0.51
30_H	63_I	0.938	0.51
52_I	60_T	0.925	0.50
25_K	47_I	0.899	0.48
64_V	113_K	0.895	0.47
25_K	91_F	0.895	0.47
43_D	69_S	0.883	0.47
81_H	88_M	0.880	0.46
37_V	75_M	0.879	0.46
109_A	114_P	0.863	0.45
2_D	5_L	0.849	0.44
33_T	106_F	0.838	0.43
47_I	50_K	0.832	0.43
44_G	106_F	0.828	0.42
37_V	105_A	0.818	0.42
98_I	101_A	0.815	0.41
21_L	29_A	0.804	0.41
20_L	32_M	0.802	0.40
44_G	50_K	0.797	0.40
20_L	104_F	0.792	0.40
97_G	101_A	0.787	0.39
38_I	42_L	0.785	0.39
88_M	92_E	0.784	0.39
3_Y	23_I	0.777	0.39
71_L	86_I	0.766	0.38
3_Y	76_H	0.764	0.38
38_I	45_F	0.763	0.38
50_K	103_L	0.744	0.36
78_A	83_F	0.740	0.36
20_L	29_A	0.736	0.36
99_S	102_I	0.731	0.35
75_M	79_H	0.726	0.35
10_G	32_M	0.719	0.34
84_I	110_V	0.717	0.34
37_V	106_F	0.715	0.34
105_A	113_K	0.714	0.34
24_F	34_S	0.713	0.34
35_F	103_L	0.709	0.34
17_G	27_T	0.708	0.34
111_I	114_P	0.708	0.34
5_L	9_C	0.708	0.34
64_V	68_H	0.700	0.33
33_T	75_M	0.696	0.33
34_S	41_I	0.695	0.33
35_F	99_S	0.690	0.32
89_G	97_G	0.690	0.32
12_A	19_L	0.678	0.32
32_M	90_I	0.674	0.31
42_L	83_F	0.672	0.31
52_I	68_H	0.671	0.31
65_S	68_H	0.670	0.31
20_L	64_V	0.669	0.31
20_L	26_L	0.668	0.31
50_K	53_E	0.667	0.31
101_A	112_F	0.666	0.31
24_F	33_T	0.664	0.31
87_G	96_A	0.663	0.31
20_L	34_S	0.662	0.31
20_L	24_F	0.661	0.30
42_L	47_I	0.659	0.30
3_Y	113_K	0.656	0.30
10_G	62_P	0.651	0.30
12_A	15_I	0.650	0.30
101_A	105_A	0.646	0.30
87_G	100_A	0.633	0.29
33_T	65_S	0.630	0.28
77_Q	81_H	0.630	0.28
47_I	51_F	0.628	0.28
107_I	115_K	0.628	0.28
26_L	30_H	0.627	0.28
75_M	83_F	0.627	0.28
32_M	44_G	0.626	0.28
55_A	108_V	0.625	0.28
94_T	108_V	0.619	0.28
51_F	94_T	0.618	0.28
106_F	114_P	0.610	0.27
62_P	89_G	0.607	0.27
51_F	55_A	0.606	0.27
22_D	36_V	0.604	0.27
68_H	94_T	0.599	0.27
26_L	48_Y	0.598	0.27
63_I	102_I	0.593	0.26
15_I	35_F	0.582	0.26
31_V	44_G	0.581	0.26
72_H	87_G	0.577	0.25
65_S	95_S	0.576	0.25
74_A	94_T	0.576	0.25
83_F	112_F	0.576	0.25
32_M	65_S	0.574	0.25
12_A	41_I	0.569	0.25
13_I	55_A	0.567	0.25
6_A	55_A	0.566	0.25
57_G	109_A	0.564	0.25
91_F	106_F	0.561	0.24
46_G	60_T	0.557	0.24
33_T	90_I	0.552	0.24
96_A	99_S	0.551	0.24
24_F	85_G	0.539	0.23
68_H	103_L	0.538	0.23
9_C	51_F	0.533	0.23
8_V	16_V	0.529	0.23
41_I	84_I	0.526	0.22
52_I	81_H	0.520	0.22
46_G	73_G	0.520	0.22
46_G	84_I	0.520	0.22
15_I	29_A	0.519	0.22
24_F	29_A	0.515	0.22
73_G	91_F	0.514	0.22
15_I	64_V	0.514	0.22
35_F	108_V	0.513	0.22
90_I	93_L	0.510	0.22
43_D	71_L	0.508	0.21
81_H	114_P	0.504	0.21
106_F	110_V	0.502	0.21
91_F	102_I	0.501	0.21
43_D	63_I	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jb0K	1	0.3362	42.9	0.928	Contact Map
4xk8K	1	0.3103	26.4	0.935	Contact Map
4kt0K	1	0.3793	12	0.945	Contact Map
3lynA	2	0.319	4.8	0.954	Contact Map
2lisA	1	0.319	4.7	0.954	Contact Map
3qnqA	2	0.9741	2.5	0.96	Contact Map
4f50A	1	0.6379	2	0.962	Contact Map
2wscK	1	0.5172	2	0.962	Contact Map
4hzuS	1	0.6983	1.5	0.965	Contact Map
2i68A	2	0.6034	1.4	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.