YOZV - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOZV - Uncharacterized membrane protein YozV

UniProt:	C0H423	Sequences: MVSKKNKIVAALLAFFFGGLGIHKFYLGRVGQGILYILFCWTGIPSIIAFIEFIIFLCGSEEGFDQKYNFYYFQQQSKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	79 (65)
Sequences:	300 (201)
Seq/√Len:	24.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_F	53_F	4.120	1.00
24_K	52_E	3.201	1.00
42_T	45_P	2.453	0.99
39_F	45_P	2.327	0.98
41_W	45_P	2.107	0.96
11_A	15_F	1.950	0.94
12_L	16_F	1.919	0.94
25_F	37_I	1.798	0.91
11_A	53_F	1.737	0.90
36_Y	45_P	1.717	0.89
24_K	56_F	1.701	0.89
49_A	53_F	1.625	0.86
43_G	49_A	1.593	0.85
15_F	49_A	1.559	0.84
24_K	32_Q	1.464	0.80
39_F	42_T	1.443	0.79
11_A	14_A	1.382	0.75
10_A	27_L	1.338	0.73
8_I	61_E	1.327	0.72
55_I	58_C	1.295	0.71
29_R	32_Q	1.288	0.70
59_G	67_K	1.243	0.67
36_Y	39_F	1.235	0.67
14_A	49_A	1.195	0.64
31_G	35_L	1.193	0.64
20_L	31_G	1.186	0.64
62_E	66_Q	1.161	0.62
32_Q	36_Y	1.143	0.61
25_F	33_G	1.101	0.58
43_G	66_Q	1.073	0.56
7_K	11_A	1.045	0.54
12_L	35_L	1.033	0.53
8_I	12_L	1.000	0.50
63_G	66_Q	0.997	0.50
59_G	63_G	0.992	0.50
13_L	38_L	0.956	0.47
10_A	62_E	0.938	0.46
52_E	56_F	0.935	0.46
29_R	67_K	0.934	0.46
19_G	46_S	0.930	0.45
16_F	50_F	0.912	0.44
5_K	26_Y	0.886	0.42
63_G	68_Y	0.863	0.41
59_G	68_Y	0.854	0.40
56_F	59_G	0.850	0.40
60_S	68_Y	0.841	0.39
40_C	54_I	0.809	0.37
29_R	56_F	0.802	0.36
16_F	22_I	0.792	0.36
36_Y	41_W	0.760	0.34
6_N	63_G	0.759	0.34
7_K	58_C	0.750	0.33
21_G	33_G	0.747	0.33
5_K	65_D	0.743	0.33
16_F	64_F	0.739	0.32
36_Y	67_K	0.729	0.32
6_N	29_R	0.725	0.31
51_I	55_I	0.696	0.30
20_L	43_G	0.692	0.29
31_G	51_I	0.690	0.29
54_I	62_E	0.688	0.29
13_L	55_I	0.688	0.29
36_Y	42_T	0.683	0.29
36_Y	56_F	0.681	0.29
19_G	38_L	0.681	0.29
45_P	67_K	0.680	0.29
28_G	38_L	0.676	0.29
27_L	64_F	0.676	0.29
29_R	65_D	0.662	0.28
31_G	58_C	0.658	0.27
15_F	28_G	0.647	0.27
4_K	56_F	0.642	0.27
32_Q	56_F	0.631	0.26
7_K	53_F	0.629	0.26
16_F	61_E	0.622	0.25
39_F	67_K	0.619	0.25
31_G	36_Y	0.618	0.25
22_I	30_V	0.606	0.25
59_G	65_D	0.602	0.24
34_I	65_D	0.585	0.23
32_Q	50_F	0.578	0.23
54_I	58_C	0.576	0.23
8_I	15_F	0.576	0.23
28_G	34_I	0.575	0.23
53_F	56_F	0.575	0.23
6_N	15_F	0.574	0.23
33_G	42_T	0.572	0.23
8_I	63_G	0.551	0.22
61_E	64_F	0.538	0.21
8_I	11_A	0.534	0.21
42_T	67_K	0.526	0.21
41_W	44_I	0.525	0.20
5_K	27_L	0.518	0.20
47_I	63_G	0.516	0.20
14_A	46_S	0.511	0.20
57_L	61_E	0.505	0.20
44_I	62_E	0.501	0.19
24_K	55_I	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gsmA	1	0.9494	5.9	0.927	Contact Map
1eysM	1	0.8987	3.6	0.934	Contact Map
2vxrA	1	0.5696	3.6	0.934	Contact Map
1gxyA	1	0.3291	3.3	0.935	Contact Map
1v54A	1	0.9494	3.3	0.935	Contact Map
2kncB	1	0.7089	3.1	0.936	Contact Map
2yevA	1	0.9494	2.5	0.939	Contact Map
1a8dA	1	0.6582	2.5	0.939	Contact Map
4gc0A	1	0.8734	2	0.942	Contact Map
4co6D	1	0.5063	2	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.