BLAP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BLAP - Biotin/lipoyl attachment protein

UniProt:	C0H419	Sequences: MTVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	73 (59)
Sequences:	1826 (1127)
Seq/√Len:	146.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_K	30_I	4.549	1.00
12_W	32_E	3.722	1.00
15_H	30_I	3.396	1.00
7_M	31_L	2.922	1.00
11_L	29_A	2.892	1.00
17_K	20_D	2.670	1.00
15_H	27_E	2.529	1.00
23_E	26_Q	1.936	1.00
59_V	62_G	1.814	1.00
24_K	29_A	1.594	1.00
5_I	8_A	1.517	1.00
14_V	29_A	1.449	1.00
38_I	43_D	1.341	1.00
16_V	26_Q	1.314	1.00
58_F	62_G	1.262	1.00
4_S	8_A	1.239	1.00
22_I	26_Q	1.233	1.00
19_G	32_E	1.212	1.00
10_N	32_E	1.154	1.00
35_K	39_P	1.107	0.99
57_D	60_N	1.059	0.99
19_G	33_S	1.040	0.99
51_V	54_K	1.037	0.99
55_E	61_E	1.035	0.99
13_K	27_E	1.028	0.99
30_I	33_S	0.970	0.98
27_E	30_I	0.902	0.97
54_K	57_D	0.902	0.97
41_V	45_S	0.880	0.97
48_V	51_V	0.873	0.97
18_A	21_Q	0.866	0.97
18_A	23_E	0.854	0.96
36_M	40_I	0.849	0.96
6_Q	31_L	0.833	0.96
25_G	41_V	0.802	0.95
48_V	52_K	0.800	0.95
19_G	25_G	0.788	0.94
53_K	57_D	0.783	0.94
11_L	17_K	0.779	0.94
7_M	33_S	0.770	0.94
38_I	41_V	0.769	0.94
11_L	14_V	0.747	0.93
34_M	46_G	0.742	0.92
11_L	31_L	0.740	0.92
23_E	60_N	0.732	0.92
52_K	58_F	0.690	0.89
24_K	31_L	0.688	0.89
53_K	58_F	0.668	0.88
39_P	44_R	0.668	0.88
55_E	62_G	0.666	0.88
16_V	22_I	0.666	0.88
52_K	55_E	0.661	0.87
7_M	10_N	0.646	0.86
49_K	53_K	0.642	0.86
44_R	47_I	0.636	0.85
21_Q	24_K	0.629	0.84
25_G	30_I	0.625	0.84
47_I	50_E	0.624	0.84
5_I	29_A	0.617	0.83
51_V	61_E	0.616	0.83
9_G	54_K	0.611	0.83
57_D	61_E	0.609	0.83
37_E	40_I	0.608	0.82
37_E	45_S	0.607	0.82
36_M	43_D	0.605	0.82
50_E	53_K	0.600	0.82
15_H	29_A	0.599	0.81
17_K	47_I	0.596	0.81
36_M	45_S	0.590	0.81
35_K	41_V	0.586	0.80
32_E	37_E	0.581	0.79
47_I	54_K	0.578	0.79
21_Q	26_Q	0.570	0.78
46_G	51_V	0.569	0.78
48_V	53_K	0.569	0.78
12_W	30_I	0.568	0.78
10_N	18_A	0.561	0.77
24_K	57_D	0.555	0.76
52_K	62_G	0.553	0.76
19_G	23_E	0.545	0.75
28_V	34_M	0.543	0.75
25_G	52_K	0.539	0.74
22_I	57_D	0.532	0.73
49_K	52_K	0.526	0.72
4_S	31_L	0.512	0.70
58_F	61_E	0.512	0.70
6_Q	48_V	0.504	0.69
19_G	55_E	0.500	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3va7A	1	0.9452	99.2	0.326	Contact Map
3hblA	4	0.9452	99.1	0.352	Contact Map
2qf7A	4	0.8493	99.1	0.356	Contact Map
4rcnA	6	0.9726	99.1	0.359	Contact Map
3bg3A	4	0.9452	99.1	0.365	Contact Map
4qshA	4	0.9589	99.1	0.367	Contact Map
3u9tA	3	0	99	0.382	Contact Map
1zy8K	1	0	99	0.385	Contact Map
3n6rA	1	0.9452	99	0.386	Contact Map
3dvaI	1	0	99	0.391	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.