YLZI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLZI - Uncharacterized protein YlzI

UniProt:	C0H412	Sequences: MIKVTRLNGQPFTLNALFIEQIECFPDTTITLSNGKKFVVKEDEEAVLEKIAAFYRKIQIFAMDQGIEEPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	71 (56)
Sequences:	38410 (32878)
Seq/√Len:	4393.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_G	53_A	2.383	1.00
10_Q	13_T	2.333	1.00
46_A	49_E	2.291	1.00
32_L	53_A	2.291	1.00
36_K	54_F	2.253	1.00
19_I	35_G	2.166	1.00
18_F	34_N	1.850	1.00
39_V	49_E	1.843	1.00
28_T	31_T	1.724	1.00
39_V	53_A	1.650	1.00
51_I	55_Y	1.486	1.00
15_N	19_I	1.403	1.00
21_Q	31_T	1.385	1.00
56_R	59_Q	1.286	1.00
22_I	31_T	1.267	1.00
61_F	64_D	1.245	1.00
15_N	42_E	1.203	1.00
43_D	47_V	1.188	1.00
29_T	61_F	1.174	1.00
42_E	46_A	1.164	1.00
33_S	37_K	1.162	1.00
29_T	57_K	1.147	1.00
22_I	32_L	1.124	1.00
25_F	28_T	1.124	1.00
15_N	39_V	1.105	1.00
11_P	41_K	1.102	1.00
32_L	56_R	1.101	1.00
12_F	42_E	1.095	1.00
37_K	40_V	1.095	1.00
15_N	38_F	1.050	1.00
15_N	35_G	1.041	1.00
11_P	38_F	1.033	1.00
20_E	23_E	1.030	1.00
35_G	39_V	1.020	1.00
39_V	46_A	1.014	1.00
20_E	24_C	1.008	1.00
40_V	47_V	1.000	1.00
17_L	20_E	1.000	1.00
56_R	60_I	0.921	1.00
40_V	54_F	0.907	1.00
37_K	41_K	0.876	1.00
14_L	18_F	0.875	1.00
13_T	16_A	0.872	1.00
21_Q	24_C	0.855	1.00
13_T	17_L	0.819	1.00
17_L	21_Q	0.818	1.00
11_P	42_E	0.803	1.00
34_N	37_K	0.791	1.00
55_Y	58_I	0.784	1.00
15_N	46_A	0.771	1.00
33_S	64_D	0.763	1.00
40_V	50_K	0.761	1.00
18_F	38_F	0.760	1.00
33_S	57_K	0.760	1.00
37_K	54_F	0.743	1.00
21_Q	28_T	0.730	1.00
27_D	60_I	0.714	1.00
49_E	52_A	0.682	1.00
19_I	53_A	0.680	1.00
30_I	34_N	0.674	1.00
50_K	54_F	0.672	1.00
32_L	60_I	0.668	1.00
32_L	57_K	0.661	1.00
38_F	42_E	0.651	1.00
17_L	53_A	0.636	1.00
29_T	33_S	0.629	1.00
30_I	33_S	0.617	1.00
36_K	57_K	0.605	1.00
29_T	64_D	0.602	1.00
53_A	56_R	0.596	1.00
16_A	20_E	0.596	1.00
18_F	31_T	0.574	1.00
57_K	60_I	0.566	1.00
19_I	39_V	0.548	1.00
49_E	53_A	0.543	1.00
21_Q	25_F	0.534	1.00
48_L	52_A	0.529	1.00
12_F	16_A	0.516	1.00
48_L	51_I	0.514	1.00
23_E	59_Q	0.514	1.00
12_F	48_L	0.512	1.00
62_A	65_Q	0.511	1.00
11_P	47_V	0.510	1.00
36_K	50_K	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4u04A	2	0.9718	99	0.2	Contact Map
2pziA	1	0.9718	99	0.206	Contact Map
4w9rA	2	0.9718	99	0.223	Contact Map
1pc2A	1	0.9718	98.9	0.227	Contact Map
3urzA	1	0.9718	98.9	0.25	Contact Map
1kt0A	2	0.9155	98.8	0.262	Contact Map
4l9pA	1	0.9718	98.8	0.267	Contact Map
2fbnA	2	0.9718	98.8	0.27	Contact Map
1tjcA	2	0.9718	98.8	0.27	Contact Map
2if4A	1	0.8028	98.8	0.271	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.