YEZG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YEZG - Probable antitoxin YezG

UniProt:	C0H3X4	Sequences: MQDLYQLIGEKLNDIIPGEWTKIYLYAEVLDDSTMVLFHFRTPENNQIIYSQDIPSHYNVSKDIFKTLLRELRELFEELRTEHRNNNDDVWTNLTLTLDRSGEFQLDYNYDDILASELDGYERIAIWEYKNLGILPEDEDDKEFVISYLGL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (146)
Sequences:	253 (162)
Seq/√Len:	13.4

BACSU - YEZG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_K	66_K	4.236	1.00
18_G	40_F	3.366	0.99
52_Q	65_F	3.310	0.98
12_L	23_I	3.205	0.98
83_H	88_D	3.126	0.98
112_D	115_A	2.744	0.95
22_K	99_D	2.685	0.94
138_D	141_D	2.282	0.87
135_L	145_V	2.165	0.84
33_S	69_L	2.075	0.81
41_R	48_I	1.923	0.76
52_Q	69_L	1.871	0.74
7_L	78_E	1.866	0.74
124_I	128_E	1.853	0.73
137_E	145_V	1.798	0.71
5_Y	8_I	1.790	0.71
28_E	123_R	1.760	0.69
26_Y	127_W	1.746	0.69
76_F	92_T	1.742	0.68
54_I	60_V	1.660	0.64
36_V	76_F	1.653	0.64
81_T	84_R	1.629	0.63
27_A	76_F	1.595	0.61
128_E	134_I	1.566	0.60
34_T	77_E	1.549	0.59
42_T	48_I	1.546	0.59
105_Q	108_Y	1.538	0.58
104_F	126_I	1.525	0.58
104_F	127_W	1.463	0.54
66_K	70_R	1.459	0.54
39_H	53_D	1.437	0.53
54_I	68_L	1.424	0.52
63_D	68_L	1.420	0.52
12_L	85_N	1.410	0.52
118_L	126_I	1.402	0.51
93_N	122_E	1.386	0.50
6_Q	87_N	1.366	0.49
65_F	85_N	1.351	0.48
97_T	131_N	1.336	0.48
94_L	108_Y	1.335	0.48
15_I	49_I	1.333	0.48
56_S	99_D	1.298	0.46
119_D	122_E	1.287	0.45
76_F	94_L	1.282	0.45
27_A	36_V	1.250	0.43
15_I	69_L	1.248	0.43
69_L	123_R	1.244	0.43
93_N	113_I	1.212	0.41
48_I	113_I	1.203	0.41
60_V	69_L	1.197	0.40
55_P	75_L	1.190	0.40
36_V	116_S	1.186	0.40
12_L	27_A	1.182	0.40
40_F	48_I	1.176	0.39
93_N	109_N	1.169	0.39
45_N	119_D	1.163	0.39
56_S	62_K	1.154	0.38
26_Y	95_T	1.130	0.37
18_G	48_I	1.104	0.36
3_D	44_E	1.095	0.35
57_H	105_Q	1.094	0.35
31_D	88_D	1.092	0.35
98_L	102_G	1.091	0.35
142_K	145_V	1.091	0.35
39_H	45_N	1.090	0.35
9_G	110_Y	1.076	0.34
68_L	92_T	1.070	0.34
48_I	58_Y	1.065	0.34
97_T	105_Q	1.056	0.33
23_I	92_T	1.056	0.33
60_V	63_D	1.053	0.33
21_T	59_N	1.051	0.33
26_Y	126_I	1.030	0.32
65_F	69_L	1.028	0.32
127_W	132_L	1.014	0.32
26_Y	39_H	1.000	0.31
53_D	56_S	0.995	0.31
36_V	118_L	0.990	0.30
125_A	128_E	0.987	0.30
34_T	73_R	0.983	0.30
138_D	142_K	0.972	0.30
39_H	130_K	0.957	0.29
4_L	105_Q	0.943	0.28
23_I	98_L	0.942	0.28
40_F	58_Y	0.935	0.28
96_L	112_D	0.929	0.28
25_L	93_N	0.928	0.28
5_Y	96_L	0.927	0.28
59_N	67_T	0.926	0.28
95_T	127_W	0.926	0.28
11_K	71_E	0.920	0.27
46_N	62_K	0.910	0.27
38_F	42_T	0.907	0.27
19_E	147_S	0.897	0.26
64_I	69_L	0.897	0.26
63_D	67_T	0.893	0.26
79_L	108_Y	0.889	0.26
9_G	102_G	0.889	0.26
21_T	47_Q	0.883	0.26
115_A	142_K	0.880	0.26
96_L	106_L	0.878	0.26
39_H	128_E	0.877	0.26
92_T	112_D	0.872	0.25
64_I	77_E	0.869	0.25
37_L	116_S	0.866	0.25
88_D	100_R	0.863	0.25
2_Q	6_Q	0.862	0.25
73_R	77_E	0.848	0.24
10_E	14_D	0.848	0.24
28_E	98_L	0.848	0.24
109_N	125_A	0.836	0.24
37_L	128_E	0.835	0.24
13_N	98_L	0.834	0.24
54_I	78_E	0.827	0.24
21_T	80_R	0.827	0.24
70_R	73_R	0.824	0.24
35_M	138_D	0.811	0.23
121_Y	130_K	0.810	0.23
32_D	90_V	0.802	0.23
62_K	70_R	0.800	0.23
50_Y	53_D	0.800	0.23
103_E	129_Y	0.794	0.22
28_E	52_Q	0.783	0.22
42_T	49_I	0.782	0.22
113_I	118_L	0.778	0.22
138_D	147_S	0.777	0.22
6_Q	24_Y	0.772	0.22
119_D	126_I	0.769	0.21
24_Y	58_Y	0.752	0.21
10_E	29_V	0.749	0.21
78_E	117_E	0.744	0.21
65_F	108_Y	0.743	0.21
15_I	72_L	0.742	0.21
12_L	112_D	0.740	0.20
33_S	107_D	0.729	0.20
8_I	17_P	0.728	0.20
103_E	108_Y	0.726	0.20
59_N	71_E	0.724	0.20
15_I	65_F	0.724	0.20
42_T	133_G	0.719	0.20
3_D	60_V	0.716	0.20
135_L	142_K	0.714	0.20
30_L	33_S	0.714	0.20
8_I	44_E	0.712	0.20
19_E	53_D	0.710	0.19
33_S	52_Q	0.708	0.19
38_F	54_I	0.707	0.19
134_I	145_V	0.703	0.19
61_S	98_L	0.702	0.19
25_L	35_M	0.693	0.19
60_V	64_I	0.692	0.19
4_L	12_L	0.688	0.19
86_N	108_Y	0.678	0.18
2_Q	98_L	0.676	0.18
74_E	77_E	0.675	0.18
17_P	72_L	0.674	0.18
138_D	143_E	0.668	0.18
5_Y	145_V	0.665	0.18
11_K	19_E	0.659	0.18
50_Y	128_E	0.650	0.18
12_L	82_E	0.650	0.18
67_T	74_E	0.633	0.17
28_E	33_S	0.631	0.17
143_E	147_S	0.630	0.17
93_N	126_I	0.627	0.17
2_Q	88_D	0.622	0.17
15_I	106_L	0.621	0.17
41_R	113_I	0.618	0.17
47_Q	85_N	0.612	0.16
21_T	85_N	0.612	0.16
139_E	143_E	0.610	0.16
2_Q	55_P	0.608	0.16
2_Q	82_E	0.606	0.16
26_Y	38_F	0.604	0.16
27_A	43_P	0.598	0.16
58_Y	68_L	0.596	0.16
27_A	123_R	0.592	0.16
25_L	51_S	0.590	0.16
113_I	131_N	0.589	0.16
6_Q	49_I	0.589	0.16
53_D	87_N	0.584	0.16
23_I	96_L	0.581	0.16
65_F	123_R	0.581	0.16
62_K	143_E	0.580	0.15
8_I	133_G	0.577	0.15
45_N	60_V	0.575	0.15
43_P	47_Q	0.575	0.15
125_A	141_D	0.574	0.15
63_D	78_E	0.572	0.15
58_Y	117_E	0.572	0.15
75_L	87_N	0.566	0.15
4_L	25_L	0.564	0.15
28_E	94_L	0.563	0.15
74_E	121_Y	0.556	0.15
18_G	58_Y	0.553	0.15
61_S	136_P	0.548	0.15
49_I	87_N	0.543	0.14
2_Q	14_D	0.540	0.14
138_D	144_F	0.539	0.14
24_Y	62_K	0.536	0.14
70_R	97_T	0.534	0.14
30_L	65_F	0.533	0.14
39_H	111_D	0.533	0.14
137_E	141_D	0.532	0.14
117_E	136_P	0.529	0.14
37_L	132_L	0.528	0.14
42_T	132_L	0.526	0.14
7_L	65_F	0.520	0.14
3_D	23_I	0.515	0.14
44_E	75_L	0.513	0.14
63_D	66_K	0.511	0.14
26_Y	37_L	0.510	0.14
56_S	66_K	0.508	0.14
103_E	122_E	0.507	0.14
88_D	147_S	0.505	0.14
18_G	42_T	0.504	0.13
119_D	143_E	0.501	0.13
68_L	94_L	0.500	0.13
26_Y	94_L	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ia1A	2	0.9735	100	0.186	Contact Map
3nuaA	2	0.8808	38.5	0.942	Contact Map
2ywvA	2	0.8808	31.6	0.944	Contact Map
2h31A	6	0.7815	23.1	0.948	Contact Map
3kreA	2	0.8808	20	0.95	Contact Map
4etnA	1	0.4305	17.1	0.951	Contact Map
3r9rA	1	0.8874	12.6	0.954	Contact Map
2wjaA	1	0.4106	10.3	0.956	Contact Map
2gqrA	2	0.8874	10.2	0.956	Contact Map
4etmA	2	0.4503	9.8	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.