YUZM - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUZM - Uncharacterized protein YuzM

UniProt:	C0H3R1	Sequences: MDNQQQSQMPPSVISTKDHLYLNDMLNWNLLAMKKAHFMAQQCQDQTLKQELDRVGHMHHDHYQRILKHLQPGQQQSGYIQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	81 (74)
Sequences:	109 (93)
Seq/√Len:	10.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_F	42_Q	3.482	0.98
25_M	29_N	3.312	0.97
57_H	61_D	2.874	0.93
29_N	36_A	2.486	0.86
14_I	39_M	2.371	0.83
51_E	55_V	2.314	0.81
33_M	56_G	2.137	0.76
25_M	36_A	2.124	0.75
56_G	60_H	2.069	0.73
27_N	55_V	2.004	0.71
26_L	70_L	1.958	0.69
5_Q	50_Q	1.681	0.56
58_M	62_H	1.676	0.56
51_E	61_D	1.564	0.51
32_A	56_G	1.493	0.47
7_S	14_I	1.492	0.47
19_H	26_L	1.480	0.47
45_D	48_L	1.296	0.38
14_I	42_Q	1.293	0.38
32_A	58_M	1.267	0.37
27_N	47_T	1.235	0.36
4_Q	10_P	1.227	0.35
66_I	69_H	1.213	0.35
61_D	65_R	1.207	0.34
22_L	75_Q	1.174	0.33
7_S	39_M	1.172	0.33
38_F	52_L	1.156	0.32
15_S	48_L	1.141	0.32
32_A	71_Q	1.136	0.31
7_S	43_C	1.129	0.31
19_H	45_D	1.108	0.30
66_I	76_Q	1.103	0.30
41_Q	49_K	1.044	0.28
46_Q	63_Y	1.013	0.27
26_L	52_L	0.999	0.26
5_Q	44_Q	0.985	0.26
9_M	76_Q	0.983	0.25
4_Q	69_H	0.979	0.25
31_L	45_D	0.967	0.25
9_M	66_I	0.954	0.24
55_V	68_K	0.952	0.24
39_M	48_L	0.951	0.24
33_M	74_Q	0.935	0.24
9_M	12_S	0.888	0.22
10_P	42_Q	0.869	0.22
15_S	67_L	0.854	0.21
5_Q	75_Q	0.843	0.21
3_N	45_D	0.842	0.21
23_N	73_G	0.835	0.20
9_M	29_N	0.828	0.20
38_F	47_T	0.821	0.20
68_K	76_Q	0.805	0.20
53_D	74_Q	0.801	0.19
23_N	29_N	0.796	0.19
39_M	50_Q	0.789	0.19
6_Q	68_K	0.787	0.19
26_L	66_I	0.783	0.19
60_H	64_Q	0.774	0.19
22_L	72_P	0.773	0.19
31_L	53_D	0.772	0.19
25_M	66_I	0.765	0.18
11_P	18_D	0.763	0.18
16_T	70_L	0.760	0.18
23_N	53_D	0.755	0.18
5_Q	26_L	0.752	0.18
9_M	75_Q	0.750	0.18
4_Q	14_I	0.744	0.18
23_N	27_N	0.742	0.18
50_Q	55_V	0.732	0.17
14_I	71_Q	0.731	0.17
42_Q	68_K	0.720	0.17
3_N	44_Q	0.719	0.17
3_N	33_M	0.711	0.17
3_N	75_Q	0.697	0.17
15_S	54_R	0.678	0.16
36_A	43_C	0.669	0.16
46_Q	49_K	0.668	0.16
12_S	73_G	0.667	0.16
16_T	31_L	0.666	0.16
13_V	71_Q	0.663	0.16
12_S	19_H	0.656	0.15
36_A	66_I	0.637	0.15
16_T	20_L	0.627	0.15
51_E	54_R	0.623	0.15
36_A	52_L	0.619	0.15
65_R	72_P	0.612	0.14
37_H	56_G	0.610	0.14
27_N	67_L	0.589	0.14
48_L	71_Q	0.588	0.14
12_S	43_C	0.587	0.14
18_D	62_H	0.585	0.14
41_Q	66_I	0.585	0.14
19_H	60_H	0.584	0.14
45_D	67_L	0.579	0.14
15_S	20_L	0.569	0.13
22_L	27_N	0.568	0.13
9_M	26_L	0.553	0.13
12_S	72_P	0.552	0.13
26_L	37_H	0.551	0.13
14_I	22_L	0.550	0.13
16_T	46_Q	0.550	0.13
16_T	37_H	0.546	0.13
16_T	26_L	0.546	0.13
41_Q	61_D	0.545	0.13
44_Q	65_R	0.540	0.13
7_S	33_M	0.529	0.13
11_P	58_M	0.528	0.13
41_Q	46_Q	0.526	0.13
8_Q	76_Q	0.509	0.12
20_L	26_L	0.504	0.12
7_S	12_S	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rbdA	4	0.9136	90.5	0.875	Contact Map
4etrA	1	0.7778	78.5	0.893	Contact Map
4am5A	6	0.8642	34.9	0.92	Contact Map
2fzfA	2	0.9012	32.5	0.921	Contact Map
2e0zA	8	0	25.2	0.925	Contact Map
4di0A	2	0.8519	24.4	0.926	Contact Map
1vjxA	1	0.9012	20.6	0.928	Contact Map
1nfvA	7	0.9012	19.1	0.929	Contact Map
2gyqA	2	0.9259	16.6	0.931	Contact Map
3k6cA	5	0.9136	13	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.