YUZN - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUZN - Uncharacterized HTH-type transcriptional regulator YuzN

UniProt:	C0H3Q8	Sequences: MNGNKDAIFKALGDSTRRLILDELSERNELTLYELTIRLITKYDLSITRQAIAKHLSVLEDAGLVTSKRKGKYRVLIFNNEPLKNLLKGWIE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	92 (80)
Sequences:	499 (221)
Seq/√Len:	24.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_T	51_A	4.984	1.00
27_R	34_E	3.772	1.00
60_E	74_R	3.530	1.00
63_G	79_N	2.522	0.99
20_I	35_L	2.432	0.98
23_E	30_L	2.386	0.98
36_T	54_K	2.239	0.97
50_Q	53_A	2.077	0.96
86_L	89_G	2.055	0.95
31_T	73_Y	1.864	0.92
36_T	50_Q	1.750	0.90
52_I	78_F	1.673	0.88
51_A	54_K	1.672	0.87
13_G	78_F	1.554	0.83
63_G	67_S	1.532	0.82
29_E	77_I	1.388	0.76
25_S	83_L	1.363	0.74
32_L	76_L	1.336	0.73
57_S	65_V	1.319	0.72
9_F	79_N	1.311	0.71
10_K	14_D	1.308	0.71
54_K	83_L	1.294	0.70
6_D	47_I	1.293	0.70
32_L	50_Q	1.281	0.69
57_S	60_E	1.259	0.68
46_S	61_D	1.251	0.68
32_L	45_L	1.156	0.61
10_K	57_S	1.147	0.61
19_L	31_T	1.129	0.59
61_D	74_R	1.124	0.59
63_G	66_T	1.120	0.59
36_T	72_K	1.094	0.57
44_D	53_A	1.085	0.56
63_G	84_K	1.081	0.56
14_D	86_L	0.975	0.48
23_E	44_D	0.967	0.48
73_Y	83_L	0.959	0.47
25_S	81_E	0.952	0.47
50_Q	76_L	0.940	0.46
50_Q	57_S	0.928	0.45
69_R	74_R	0.901	0.43
35_L	73_Y	0.896	0.43
12_L	78_F	0.895	0.43
20_I	44_D	0.893	0.43
84_K	87_L	0.888	0.42
19_L	88_K	0.879	0.42
46_S	80_N	0.874	0.41
27_R	44_D	0.872	0.41
28_N	77_I	0.869	0.41
47_I	52_I	0.868	0.41
53_A	57_S	0.864	0.40
20_I	47_I	0.852	0.40
6_D	27_R	0.848	0.39
66_T	79_N	0.839	0.39
47_I	89_G	0.839	0.39
6_D	52_I	0.814	0.37
24_L	30_L	0.800	0.36
36_T	51_A	0.794	0.36
67_S	74_R	0.789	0.35
25_S	65_V	0.783	0.35
22_D	89_G	0.779	0.35
21_L	89_G	0.778	0.35
7_A	61_D	0.775	0.34
22_D	69_R	0.757	0.33
23_E	73_Y	0.752	0.33
8_I	13_G	0.741	0.32
15_S	68_K	0.740	0.32
56_L	60_E	0.739	0.32
33_Y	53_A	0.723	0.31
13_G	91_I	0.717	0.31
16_T	69_R	0.705	0.30
34_E	73_Y	0.701	0.30
78_F	88_K	0.694	0.29
9_F	86_L	0.694	0.29
27_R	33_Y	0.693	0.29
66_T	78_F	0.691	0.29
16_T	45_L	0.690	0.29
33_Y	66_T	0.688	0.29
47_I	80_N	0.688	0.29
83_L	86_L	0.681	0.29
57_S	83_L	0.681	0.29
15_S	19_L	0.679	0.29
29_E	32_L	0.674	0.28
28_N	84_K	0.666	0.28
10_K	70_K	0.658	0.27
51_A	87_L	0.657	0.27
29_E	79_N	0.653	0.27
28_N	50_Q	0.652	0.27
50_Q	54_K	0.650	0.27
35_L	85_N	0.645	0.27
48_T	54_K	0.642	0.26
10_K	68_K	0.639	0.26
6_D	28_N	0.630	0.26
9_F	46_S	0.609	0.25
20_I	30_L	0.602	0.24
68_K	85_N	0.599	0.24
28_N	76_L	0.586	0.23
7_A	69_R	0.583	0.23
86_L	91_I	0.580	0.23
26_E	58_V	0.580	0.23
34_E	86_L	0.574	0.23
52_I	62_A	0.574	0.23
31_T	35_L	0.573	0.23
47_I	54_K	0.571	0.23
70_K	73_Y	0.557	0.22
16_T	46_S	0.555	0.22
27_R	66_T	0.555	0.22
10_K	69_R	0.544	0.21
25_S	33_Y	0.539	0.21
18_R	71_G	0.536	0.21
30_L	34_E	0.534	0.21
20_I	56_L	0.527	0.20
80_N	85_N	0.524	0.20
31_T	75_V	0.524	0.20
22_D	90_W	0.524	0.20
19_L	35_L	0.517	0.20
16_T	19_L	0.516	0.20
25_S	28_N	0.505	0.19
26_E	70_K	0.502	0.19
24_L	72_K	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1r1tA	2	0.9239	99.3	0.67	Contact Map
1q1hA	1	0.8478	99.2	0.679	Contact Map
2jscA	2	0.8913	99.2	0.683	Contact Map
1u2wA	2	0.9348	99.2	0.684	Contact Map
1r1uA	2	0.9239	99.2	0.691	Contact Map
2qlzA	2	0.8587	99.1	0.692	Contact Map
2zkzA	2	0.913	99.1	0.693	Contact Map
2kkoA	2	0.913	99.1	0.693	Contact Map
2p4wA	2	0.913	99.1	0.7	Contact Map
4k2eA	2	0.9239	99.1	0.7	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.