PDB Model Database

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Model b4d7a_94e55

PDB info		Alignment MKTFVATLVVFAILVGFSTFTYNYINNTTDDLMAHIQVMEKHLRARNWQQAEQGFSKLKSSWDRTSSNWAVFIDHQELDSINMSMARLKNYMDTREKPELLAELGELKLLLKHIPEKEALNLKNIL \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| ---------VFAILVGFSTFTYNYINNTTDDLMAHIQVMEKHLRARNWQQAEQGFSKLKSSWDRTSSNWAVFIDHQELDSINMSMARLKNYMDTREKPELLAELGELKLLLKHIPEKEALNLKNIL	Contact info
Model:	Download		Seq90:	2115
Chains:	A		Seq80:	1921
Length:	117		Length:	126
Rc:	0.962		Seq/√Len:	171.8

Legend: GREMLIN results overlaid on PDB contacts. The grey/red filled circles underneath are pdb residue contacts (min distance < 5(dark) - 10(light) Angstroms). Inter oligomeric contacts in the pdb are in shades of red. Get full list of distances.

Score cutoff: Add Label
Legend: GREMLIN results. Distance <5 (Green), 5-10 (yellow), and >10 (red). 3D graphs powered by 3Dmol.js.

Legend: The i and j are positions as given in the PDB in the format: chain:id_resn

Legend: Distance vs. Score. Roll mouseover to get (i,j) pdb numbers.